teduglutide

Ligand id: 7049

Name: teduglutide

Peptide Sequence
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp