insulin glargine

Ligand id: 7572

Name: insulin glargine

Peptide Sequence
No information available.
Chemical Modification
The A chain has peptide sequence GIVEQCCTSICSLYQLENYCG, where the C terminal glycine replaces the natural asparagine. The B chain has the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR which has two additional C-terminal arginine residues compared to endogenous insulin. Disulphide bond formation is equivalent to that observed in the endogenous active hormone dimer.