GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

andexanet alfa   Click here for help

GtoPdb Ligand ID: 7576

Synonyms: Andexxa® | coagulation factor Xa (recombinant), inactivated-zhzo | Ondexxya® | PRT064445 | PRT4445 | r-antidote
Approved drug
andexanet alfa is an approved drug (FDA (2018), EMA (2019))
Compound class: Peptide
Comment: Andexanet alfa is a recombinant modified human Factor Xa (FXa) protein that acts as a mimetic of endogenous human factor Xa, and which was developed as a universal antidote to reverse thhe anticoagulant effects of direct or indirect FXa inhibitors. Information regarding the invention of andexanet alfa is available in patent WO2009042962 [2].
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: andexanet alfa

Peptide Sequence Click here for help
ANSFLFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARG
YTLADNGKACIPTGPYPCGKQTLERRKRRKRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKR
FKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSG
FGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGIVSWGEGC
ARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK
Chemical Modification
The hexapeptide RKRRKR is used to link the modified light and heavy chains of human factor X to generate the recombinant r-antidote peptide [1].