peginterferon beta-1a

Ligand id: 7637

Name: peginterferon beta-1a

Peptide Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL
TGYLRN
Chemical Modification
Recombinant human peptide is covalently linked to a 20 kDa mPEG-OH molecule at the N-terminal α-amino group [1].