GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

dendrotoxin-k   Click here for help

GtoPdb Ligand ID: 7738

Synonyms: DTX-K | Kunitz-type serine protease inhibitor homolog dendrotoxin K | venom basic protease inhibitor K
Compound class: Peptide
Comment: From the venom of Dendroaspis polylepis polylepis (Black mamba)
Click here for help
Peptide Sequence Click here for help
AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG
Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Leu-Arg-Ile-Gly-Pro-Cys-Lys-Arg-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 5 and 55, 14 and 38, and 30 and 51.