|
Synonyms: fibroblast growth factor 23
Compound class:
Endogenous peptide in human, mouse or rat
Comment: FGF-23 regulates phosphate homeostasis and calcium transport in the kidney [3]. The full-length 327 amino acid protein is functional, and is deactivated by proteolytic cleavage which generates N-terminal and C-terminal chains. Mutation of the cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR), and other gene alterations are associated with hyperphosphatemic familial tumoral calcinosis (HFTC). Antibody-driven inactivation of FGF-23 is being investigated as a pharmacological intervention in these indications. Burosumab (KRN23) is one such FGF-23 neutralising antibody in clinical development.
A FGFR1 isoform [FGFR1(IIIc)] in complex with the Klotho protein (KL; Q9UEF7) forms a high affinity receptor for FGF-23 [1-2,4].
Species: Human
|
Peptide Sequence  |
|
|
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFG SHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDD SERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
|
