|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Gremlin 1 is a member of a family of proteins (the DAN family) that are peptide antagonists of TGF-β family bone morphogenetic proteins (BMP) [4] including BMP2 and BMP4. DAN family members can also modulate Wnt and vascular endothelial growth factor (VEGF) signalling pathway activities. BMP/BMP antagonist interactions regulate developmental and normal cellular processes. In contrast, dysregulation of these interactions has been associated with pathological processes such as carcinogenesis and fibrosis. Gremlin 1 has emerged as a molecular target for the development of novel therapeutics for relevant conditions [1-3].
Species: Human
|
Peptide Sequence  |
|
|
msrtaytvgalllllgtllpaaegKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVLESSQEA LHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPE LQPPTKKKRVTRVKQCRCISIDLD |
|
| Post-translational Modification | |
| Signal peptide is shown in lower case; asparagine 42 is glycosylated; there are 4 intramolecular disulphide bonds (94>144, 108>158, 118>176, 22>178) | |
