brain natriuretic peptide

Ligand id: 4890

Name: brain natriuretic peptide

Abbreviated name: BNP

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: brain natriuretic peptide

Peptide Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His
Selected 3D Structures
PDB Id: 3N56
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 1 and 112