insulin-like growth factor 1   Click here for help

GtoPdb Ligand ID: 4971

Abbreviated name: IGF-1
Synonyms: CEP-151 | mechano growth factor (MGF) | myotrophin
Approved drug
insulin-like growth factor 1 is an approved drug (FDA (2005))
Compound class: Endogenous peptide in human, mouse or rat
Comment: The recombinant form of human IGF-1 is an approved drug, mecasermin.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: insulin-like growth factor 1

Peptide Sequence Click here for help
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Selected 3D Structures
PDB Id: 1bqt
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 6 and 48, 18 and 61, and 47 and 52