insulin-like growth factor 1

Ligand id: 4971

Name: insulin-like growth factor 1

Abbreviated name: IGF-1

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: insulin-like growth factor 1

Peptide Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Selected 3D Structures
PDB Id: 1bqt
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 6 and 48, 18 and 61, and 47 and 52