calcitonin

Ligand id: 685

Name: calcitonin

Abbreviated name: CT

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: calcitonin

Peptide Sequence
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2
Post-translational Modification
The C-terminal proline is amidated into Pro-NH2 and disulphide bridge forms between cysteine residues at positions 1 and 7.