belatacept

Ligand id: 6892

Name: belatacept

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: belatacept

Peptide Sequence
MHVAQPAVVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQ
GLRAMDTGLYICKVELMYPPPYYEGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
The drug is a dimeric protein, consisting of two identical subunits linked by a disulphide bridge (between Cys120 on each subunit). The sequence shown above is for a single monomer. Intra-subunit disulphide bridges form between cysteines 21-92, 48-66, 171-231 and 277-335. There are glycosylation sites at Asn76, Asn108, Ser129, Ser139 and Asn207. This additional structural information is taken from the INN record for the drug.