oprelvekin

Ligand id: 6971

Name: oprelvekin

Peptide Sequence
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAM
SAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPP
LAPPSSAWGGIRAAHAILGG LHLTLDWAVRGLLLLKTRL