GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

interleukin-17D   Click here for help

GtoPdb Ligand ID: 14474

Synonyms: IL-17D
Immunopharmacology Ligand
Comment: IL-17D is expressed in skeletal muscle, heart, and adipose tissue. In endothelial cells it induces expression of pro-inflammatory cytokines IL-6, IL-8 (CXCL8) and GM-CSF (CSF2) via the NF-κB and MAPK signaling pathways. A functional receptor for IL-17D is proposed to be CD93 (UniProt entry Q8TAD2; CD93) [1-3].
Species: Human
Peptide Sequence Click here for help
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADR
RFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAY
VTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Post-translational Modification
N-linked glycosylation (GlcNAc) at asparagines 68 and 181; signal peptide MLVAGFLLALPPSWA