GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Pi-theraphotoxin-Hm3a   Click here for help

GtoPdb Ligand ID: 10305

Synonyms: π-TRTX-Hm3a
Compound class: Peptide
Comment: Pi-theraphotoxin-Hm3a is a venom derived peptide isolated from Heteroscodra maculata (Togo starburst tarantula). It is a potent and highly stable tool for the study of ASIC channel function.
Click here for help
Peptide Sequence Click here for help
EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV
Glu-Pro-Cys-Ile-Pro-Lys-Trp-Lys-Ser-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Ala-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Lys-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Val