GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

norrin   Click here for help

GtoPdb Ligand ID: 1063

Synonyms: Norrie disease protein | X-linked exudative vitreoretinopathy 2 protein
Comment: Norrin is the protein product of the Norrie disease gene NDP. It is a secreted protein whose biochemical function is not yet fully understood.
Species: Human
Peptide Sequence Click here for help
KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLK
ALRLRCSGGMRLTATYRYILSCHCEECNS
Lys-Thr-Asp-Ser-Ser-Phe-Ile-Met-Asp-Ser-Asp-Pro-Arg-Arg-Cys-Met-Arg-His-His-Tyr-Val-Asp-Ser-Ile-Ser-His-Pro-Leu-Tyr-Lys-Cys-Ser-Ser-Lys-Met-Val-Leu-Leu-Ala-Arg-Cys-Glu-Gly-His-Cys-Ser-Gln-Ala-Ser-Arg-Ser-Glu-Pro-Leu-Val-Ser-Phe-Ser-Thr-Val-Leu-Lys-Gln-Pro-Phe-Arg-Ser-Ser-Cys-His-Cys-Cys-Arg-Pro-Gln-Thr-Ser-Lys-Leu-Lys-Ala-Leu-Arg-Leu-Arg-Cys-Ser-Gly-Gly-Met-Arg-Leu-Thr-Ala-Thr-Tyr-Arg-Tyr-Ile-Leu-Ser-Cys-His-Cys-Glu-Glu-Cys-Asn-Ser
Post-translational Modification
Disulfide bonds formed between cysteine residues at positions 15 and 72; 31 and 86; 41 and 102; 45 and 104