GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PiN-21   Click here for help

GtoPdb Ligand ID: 11551

Synonyms: Pittsburgh inhalable Nanobody 21
Compound class: Antibody
Comment: PiN-21 is a nanobody that has been developed by scientists from the University of Pittsburgh, as an inhalable, injection-free therapy for SARS-CoV-2 infections [1]. It was chosen from a previously identified repertoire of potent neutralizing nanobodies to the SARS-CoV-2 spike protein receptor binding domain (RBD), that were raised in Llamas immunised with the recombinant RBD [2]. PiN-21 has demonstrated preventative and therapeutic efficacy in a hamster model that replicates moderate to severe COVID-19 disease. In this model PiN-21 achieves widespread distribution in the respiratory tract, and is active at very low concentrations. Treatment decreases viral load in the lung, reduces lung pathology, and prevents progression to viral pneumonia.
Click here for help
Peptide Sequence Click here for help
QVQLVESGGGLVQAGGSLRLSCAVSGLGAHRVGWFRRAPGKEREFVAAIGANGGNTNYLDSVKGRFTISRDNAKNTIYLQ
MNSLKPQDTAVYYCAARDIETAEYTYWGQGTQVTVSS