GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ontorpacept   Click here for help

GtoPdb Ligand ID: 12036

Synonyms: TTI-621 | TTI621
Compound class: Peptide
Comment: Ontorpacept (TTI-621) is a 345 amino acid fusion protein that consists of the N-terminal V domain of human SIRPα fused to the Fc region of human IgG1 that was designed as an immuno-oncology agent [1]. The SIRPα domain binds to CD47 on cancer cells (to block the CD47-SIRPα anti-phagocytic signal). Inclusion of the IgG1 Fc region enhances phagocytosis of malignant cells via interaction with Fcγ receptors.
Click here for help
Peptide Sequence Click here for help
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENMDFSISISN
ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK