iPep-SARS2-E   Click here for help

GtoPdb Ligand ID: 13253

Synonyms: TAT-MY18-2ED [1]
Compound class: Peptide
Comment: This is a small cell-penetrating peptide that targets coronavirus envelope (E) protein [1]. The first 13 amino acids represent a sequence that facilitates membrane penetration. Amino acids 14-31 are derived from the N-terminal (and extraviral) region of E protein, with Glu7 and Glu8 replaced by Asp residues. Experimental evidence suggests that iPep-SARS2-E integrates into SARS-CoV-2 E protein oligomers and reduces the E-mediated channel current in HEK cells.
Peptide Sequence Click here for help
GRKKRRQRRRPPQMYSFVSDDTGTLIVNSVL