From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

FAM150B   Click here for help

GtoPdb Ligand ID: 14204

Synonyms: ALKAL2 | AUG-α | augmentor-α | augmentor-alpha
Comment: FAM150B (AUG-α) is an endogenous leukocyte receptor tyrosine kinase (LTK) and ALK receptor tyrosine kinase (ALK) activating ligand [1-2].
Species: Human
Peptide Sequence Click here for help
MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSP
EQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ