GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

povetacicept   Click here for help

GtoPdb Ligand ID: 14426

Synonyms: ALPN-303 | TACI vTD-Fc
Immunopharmacology Ligand
Compound class: Peptide
Comment: Povetacicept (ALPN-303) is a Fc fusion protein that contains a variant TACI domain of the TNFRSF13B receptor for the peptide cytokines B cell activating factor (BAFF; TNFSF13B) and a proliferation-inducing ligand (APRIL; TNFSF13) [2]. It functionally antagonises the cellular signalling pathways of these ligands via TNFRSF13B on B cells.
In the peptide sequence provided the TACI domain is amino acids 1-43, with a short linker (GSGGGGS 44-50 ) and the remainder being the Fc domain. The functional peptide is a dimer, linked by inter-chain disulphide bridges.
Peptide Sequence Click here for help
SLSCRKEQGEYYDHLLRDCISCASICGQHPKQCADFCENKLRSGSGGGGSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG