GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

histatin 1   Click here for help

GtoPdb Ligand ID: 14556

Comment: Histatin 1 is an endogenous cationic and histidine-rich secreted peptide. It binds to the σ2 receptor (TMEM97) on epithelial cells [8-9], and to the VEGFR2 (KDR) on endothelial cells [4]. Histatin 1 is the primary wound healing agent in saliva. It acts as a potent promoter of cell migration and angiogenesis [11], two important biological processes that contribute to the rapid rate of wound healing in the oral mucosa.
Preclinical evidence suggests that histatin 1, or more likely metabolically stablised derivatives, offer a novel therapeutic mechanism in non-oral tissues for wound healing properties [1-3,5-6,13], or for potential osteogenic activity [7,10,12,14].
Species: Human
Click here for help
Peptide Sequence Click here for help
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Post-translational Modification
Signal peptide (amino acids 1-19)