GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Max.d.4   Click here for help

GtoPdb Ligand ID: 2265

Synonyms: des-(Leu24-Leu42)-maxadilan | maxadilan Δ24-42
Compound class: Peptide
Comment: The properties of this maxadilan analogue were first described in [1].
Peptide Sequence Click here for help
CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKKEFKAGK
Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-Gly-Lys
Post-translational Modification
There are predicted to be disulphide bonds between Cys1 and Cys5, and Cys14 and Cys32.