GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ω-agatoxin IVB   Click here for help

GtoPdb Ligand ID: 2530

Synonyms: Omega-agatoxin-Aa4b
Compound class: Peptide
Comment: From the venom of Agelenopsis aperta (North American funnel-web spider)
Click here for help
Peptide Sequence Click here for help
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
Glu-Asp-Asn-Cys-Ile-Ala-Glu-Asp-Tyr-Gly-Lys-Cys-Thr-Trp-Gly-Gly-Thr-Lys-Cys-Cys-Arg-Gly-Arg-Pro-Cys-Arg-Cys-Ser-Met-Ile-Gly-Thr-Asn-Cys-Glu-Cys-Thr-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Ser-Phe-Ala
Post-translational Modification
Serine residue at position 48 is D-Ser