GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

kaliotoxin   Click here for help

GtoPdb Ligand ID: 2546

Synonyms: BmKTX | KTX | potassium channel toxin α-KTx 3.6
Compound class: Peptide
Comment: From Mesobuthus martensii (Manchurian scorpion)
Click here for help
Peptide Sequence Click here for help
VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPK
Val-Gly-Ile-Asn-Val-Lys-Cys-Lys-His-Ser-Gly-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Gly-Lys-Cys-Asp-Cys-Thr-Pro-Lys-NH2
Post-translational Modification
C-terminal lysine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 7 and 47, 13 and 32, and 17 and 34.