GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

APETx-1   Click here for help

GtoPdb Ligand ID: 2609

Synonyms: Toxin APETx1
Compound class: Peptide
Comment: From Anthopleura elegantissima (Sea anemone)
Click here for help
Peptide Sequence Click here for help
GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD
Gly-Thr-Thr-Cys-Tyr-Cys-Gly-Lys-Thr-Ile-Gly-Ile-Tyr-Trp-Phe-Gly-Thr-Lys-Thr-Cys-Pro-Ser-Asn-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Gly-Tyr-Phe-Leu-Gly-Ile-Cys-Cys-Tyr-Pro-Val-Asp
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 37, 6 and 30, and 20 and 38.