From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

muscarinic toxin 3   Click here for help

GtoPdb Ligand ID: 313

Synonyms: mamba toxin-3 | MT3
Compound class: Peptide
Comment: MT3 (M4-toxin), like MT7 (M1-toxin), is a toxin from the venom of the Eastern green mamba (Dendroaspis augusticeps) [1,3,5].
Click here for help
Peptide Sequence Click here for help
LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE
Leu-Thr-Cys-Val-Thr-Lys-Asn-Thr-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asn-Cys-Pro-Ala-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-His-Tyr-Val-Ile-Pro-Arg-Tyr-Thr-Glu-Ile-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn-Glu
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 3 and 24, 17 and 42, 46 and 57 and 58 and 63