GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

gastric inhibitory polypeptide   Click here for help

GtoPdb Ligand ID: 3543

Abbreviated name: GIP
Synonyms: gastric inhibitory peptide | glucose-dependent insulinotropic polypeptide
Comment: Mouse GIP differs from human GIP at residues 18 (Arginine), 30 (Arginine) and 34 (Serine) and from rat GIP at residues 30 (Arginine), 34 (Serine) and 40 (Isoleucine).
Species: Mouse
Peptide Sequence Click here for help
YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Arg-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln