GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

adrenomedullin   Click here for help

GtoPdb Ligand ID: 3589

Abbreviated name: AM
Synonyms: mouse adrenomedullin
Species: Mouse
Peptide Sequence Click here for help
YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY
Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Asn-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Phe-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Leu-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Post-translational Modification
The cysteine residues at positions 14 and 19 form a disulphide bridge and the C-terminal tyrosine is amidated.