GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sFRP-1   Click here for help

GtoPdb Ligand ID: 3691

Synonyms: SARP-2 | secreted apoptosis-related protein 2
Species: Human
Peptide Sequence Click here for help
SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQV
FLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDN
ELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIM
GRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK
Post-translational Modification
N-linked glycosylation od aspargine residue at position 142; disulfide bonds between Cysteine residues at positions 27 and 90; 37 and 83; 74 and 109; 98 and 135; 102 and 126; 155 and 225; 158 and 227; 172 and 275