GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sFRP-3   Click here for help

GtoPdb Ligand ID: 3693

Synonyms: Frezzled | Frizzled-related protein 1 | secreted Frizzled-related protein 3
Comment: This peptide is encoded by the FRZB gene. It acts as a Wnt signaling antagonist that is expressed in chondrocytes and functions in bone development [1].
Species: Human
Peptide Sequence Click here for help
AACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVC
ERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFR
NNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEG
SIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
Post-translational Modification
Asparagine residue at position 17 is N-linked glycosylated; disulfide bonds formed between cysteine residues at positions 3 and 64; 11 and 57; 48 and 87; 76 and 115; 80 and 104