GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

amphiregulin   Click here for help

GtoPdb Ligand ID: 4864

Synonyms: colorectal cell-derived growth factor (CRDGF)
Immunopharmacology Ligand
Comment: Amphiregulin is an epidermal growth factor family member that is involved in tissue repair.
Species: Human
Peptide Sequence Click here for help
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEK
Selected 3D Structures
PDB Id: 2RNL
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residue at position 19; predicted N-linked glycosylation of asparagine at position 113. Predicted disulphide bond formation between cysteine resdiues at positions 46 and 59, 54 and 70, and 72 and 81