GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

artemin   Click here for help

GtoPdb Ligand ID: 4871

Abbreviated name: ARTN
Comment: Biologically active artemin is a disulphide-linked homodimer
Species: Human
Peptide Sequence Click here for help
AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPC
CRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Selected 3D Structures
PDB Id: 2GYR
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Biologically active peptide is a homodimer. Disulphide bond formation between cysteine residues at positions 16 and 81, 43 and 109, and 47 and 111. Interchain disulphide bomd between cysteine residues at position 80 of each chain; predicted N-linked glycosylation of asparagine residue at position 95