Abbreviated name: ARTN
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Biologically active artemin is a disulphide-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPC CRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
Selected 3D Structures | ||
|
Post-translational Modification | |
Biologically active peptide is a homodimer. Disulphide bond formation between cysteine residues at positions 16 and 81, 43 and 109, and 47 and 111. Interchain disulphide bomd between cysteine residues at position 80 of each chain; predicted N-linked glycosylation of asparagine residue at position 95 |