From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.
|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
|
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMN ATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 103 of each chain. Predicted N-linked glycososylation of asparagine residues at positions 10, 29 and 80. Disulphide bond formation between cysteine residues at positions 38 and 104, 67 and 136, and 71 and 138 | |