GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BMP-8B   Click here for help

GtoPdb Ligand ID: 4888

Synonyms: BMP-8
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMN
ATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 103 of each chain. Predicted N-linked glycososylation of asparagine residue at position 80. Predicted disulphide bond formation between cysteine residues at positions 38 and 104, 67 and 136, and 71 and 138