From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

chorionic somatomammotropin hormone-like 1    Click here for help

GtoPdb Ligand ID: 4894

Synonyms: chorionic somatomammotropin-like | lactogen-like
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
VQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLEL
LHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDA
LLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 187 and 194