GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: IFN alpha-14 | interferon alpha-14 | interferon alpha-H | interferon lambda-2-H
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α14 is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDET LLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQK RLRRKD |
Post-translational Modification | |
N-linked glycosylation of asparagine residue at position 63; predicted disulphide bonds between cysteine residues at positions 1 and 99, and 29 and 39 |