GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α6   Click here for help

GtoPdb Ligand ID: 4964

Synonyms: IFN-alpha-6 | interferon alpha-54 | interferon alpha-6 | interferon alpha-K
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-α6 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAW
DERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 4 and 102, and 32 and 142