GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: catabolin | interleukin-1 beta
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-1β is an IL-1 family cytokine produced from the IL1B gene. It is produced by activated macrophages as a proprotein which is cleaved by cytosolic caspase 1 to the mature, active molecule.
Species: Human
|
Peptide Sequence ![]() |
|
|
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
|
| Selected 3D Structures | ||
|
||