From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-9   Click here for help

GtoPdb Ligand ID: 5000

Synonyms: interleukin-9
Immunopharmacology Ligand
Comment: IL-9 is a pleiotropic cytokine. Th9 cells and/or the IL-9/IL-9 receptor pathway are potential targets for pharmacological intervention in atopic diseases such as asthma and ulcerative colitis.
Species: Human
Peptide Sequence Click here for help
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV
LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Post-translational Modification
Predicted N-linked glycosylation of asparagine resdidues at positions 32, 45, 60 and 96