From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

inhibin βE   Click here for help

GtoPdb Ligand ID: 5009

Synonyms: activin beta-E chain | inhibin beta E chain
Species: Human
Peptide Sequence Click here for help
TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCV
PTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Post-translational Modification
Predicted to form an active peptide homo or heterodimer through association with alpha or beta subunits, linked by one or more disulphide bonds. Predicted interchain disulphide bond formation between cysteine residues at positions 80; predicted disulphide bond formation between cysteine resisdues at positions 4 and 12, 11 and 79, 40 and 111, and 44 and 113