GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

neurotrophin-4   Click here for help

GtoPdb Ligand ID: 5034

Abbreviated name: NT-4
Synonyms: neurotrophin-5 | NT-5
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRG
VDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Selected 3D Structures
PDB Id: 1b98
Image of ligand 3D structure from RCSB PDB 		PDB Id: 1b8m
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 17 and 90, 161 and 119, and 78 and 121