GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: Flt4 ligand (Flt4-L) | vascular endothelial growth factor-related protein | VEGF-C
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a non-convalent and anti-parallel homodimer linked by disulphide bonds
Species: Human
|
Peptide Sequence ![]() |
|
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVP LSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
Selected 3D Structures | ||
|
Post-translational Modification | |
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 45 and 54; further disulphide bonds formed between cysteine residues at positions 20 and 62, 51 and 108, and 55 and 100. N-linked glycosylation of asparagine residues at positions 66 and 94; predicted N-linked glycosylation of asparagine at 129 |