GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Abbreviated name: FLIP subunit p12
Synonyms: CASP8 and FADD-like apoptosis regulator subunit p12
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This is the short isoform of cFLIP (c-FLIPS). It is acts as a death receptor inhibitor, by antagonising procaspase-8 incorporation into the death-inducing signaling complex (DISC), and has modulatory actions on the immune system (upregulated by T cell receptor activation).
Species: Human
|
Is a component of |
FLICE-like inhibitory protein |
Peptide Sequence ![]() |
|
GPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSR VSAKEKYYVWLQHTLRKKLILSYT |