From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-27 subunit α   Click here for help

GtoPdb Ligand ID: 6152

Synonyms: IL-27 subunit alpha | interleukin-27 subunit alpha | p28
Immunopharmacology Ligand
Comment: This is one of the subunits of biologically active IL-27.
Species: Human
Is a component of
Peptide Sequence Click here for help
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCF
ISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSA
LQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP