GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

C4a   Click here for help

GtoPdb Ligand ID: 6547

Synonyms: C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2
Species: Human
Peptide Sequence Click here for help
NVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQR
Asn-Val-Asn-Phe-Gln-Lys-Ala-Ile-Asn-Glu-Lys-Leu-Gly-Gln-Tyr-Ala-Ser-Pro-Thr-Ala-Lys-Arg-Cys-Cys-Gln-Asp-Gly-Val-Thr-Arg-Leu-Pro-Met-Met-Arg-Ser-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Val-Gln-Gln-Pro-Asp-Cys-Arg-Glu-Pro-Phe-Leu-Ser-Cys-Cys-Gln-Phe-Ala-Glu-Ser-Leu-Arg-Lys-Lys-Ser-Arg-Asp-Lys-Gly-Gln-Ala-Gly-Leu-Gln-Arg
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 22 and 48, 23 and 55, and 36 and 56.