GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

obtustatin   Click here for help

GtoPdb Ligand ID: 6581

Compound class: Peptide
Comment: From the venom of Macrovipera lebetina obtusa (Levant blunt-nosed viper). A potent and selective integrin α1β1 inhibitor.
Click here for help
Peptide Sequence Click here for help
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly
Post-translational Modification
Disulfide bridge between residues 1 and 10, 6 and 29, 7 and 34, 19 and 36