GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

aflibercept   Click here for help

GtoPdb Ligand ID: 6786

Synonyms: AVE0005 | Eylea® | VEGF Trap | Zaltrap® | ziv-aflibercept
Approved drug
aflibercept is an approved drug (FDA (2011), EMA (2012))
Compound class: Peptide
Comment: Alfibercept is a fusion protein combining the Fc portion of human IgG with the ligand binding domains of the VEGRF1 and VEGRF2 receptors.

Biosimilars:
Patent protection for originator alfibercept was expected to expire earliest in Japan and China (2022), then in US (2023, if Regeneron's extended patent claims were accepted) and the EU (2025), and biosimilar development proceeded during the run-up to patent expiry [4]. Early examples included Momenta Pharmaceuticals/Mylan's M710MYL-1701P, Alteogen's ALT-L9 (a heat stabilised formulation with a predicted longer shelf-life than Eylea; NCT04058535), and Formycon/Santo Holdings' FYB203.

The table below lists Eylea biosimilars with regulatory approval.

NameTrade nameCompanyApprovalsIndications
aflibercept-jbvfYesafili®Biocon BiologicsUK MHRA & EMA (2023), FDA (2024)As per originator reference product; interchangeable
aflibercept-yszy (SB15)Opuviz®BiogenFDA (2024)As per originator reference product; interchangeable
aflibercept-mrbb (FYB203)Ahzantive®, Baiama® Formycon/Klinge BiopharmaFDA (2024), EMA (2025)As per originator reference product
aflibercept-abzv (SOK583A1)Enzeevu®SandozFDA (2024)As per originator reference product
aflibercept-ayyh (ABP 938) [3]Pavblu ®AmgenFDA (2024)As per originator reference product
aflibercept biosimilar (CT-P42) Eydenzelt®CelltrionEMA (2025)As per originator reference product
aflibercept biosimilar; ALT-L9Eyluxvi®Biolitec PharmaEMA (2025)As per originator reference product
aflibercept biosimilarAfiveg®STADA ArzneimittelEMA (2025)As per originator reference product
aflibercept biosimilar; AVT06Mynzepli®Alvotech/Advanz PharmaEMA (2025)As per originator reference product
aflibercept biosimilarEiyzey®; Vgenfli®Zaklady FarmaFarmaceutyczne/PolpharmaEMA (2025)As per originator reference product
Peptide Sequence Click here for help
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCE
ATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSG
SEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT
ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Post-translational Modification
This is a recombinant fusion protein comprising vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 fused to the Fc portion of human IgG1. It exists as a dimer, covalently linked by disulphide bridges.
Chemical Modification
Covalent disulphide bonds form between amino acids as follows:
Intra peptide disulphide bonds (30-79, 124-185, 246-306, 352-410)
Inter peptide disulphide bonds (214-214, 211-211)