GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

seractide acetate   Click here for help

GtoPdb Ligand ID: 6966

Approved drug
seractide acetate is an approved drug (FDA (1978))
Compound class: Peptide
Comment: This peptide is the acetate salt of full length (39 amino acid) human corticotropin. It has a US approved name (USAN) but no international approved name (INN) and does not appear on the US FDA current drug list. This appears to be a discontinued injectable repository from of corticotropin. See FDA New Drug Application (NDA) 017861
Peptide Sequence Click here for help
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Chemical Modification
This is the acetate salt of human corticotropin