GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

cangitoxin II   Click here for help

GtoPdb Ligand ID: 7568

Synonyms: cangitoxin-2 | cangitoxin-II | CGTX-II
Compound class: Peptide
Comment: Sea anemone toxin from Bunodosoma cangicum.
Click here for help
Peptide Sequence Click here for help
GVACRCDSDGPTVRGDSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK
Gly-Val-Ala-Cys-Arg-Cys-Asp-Ser-Asp-Gly-Pro-Thr-Val-Arg-Gly-Asp-Ser-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Thr-Gly-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Arg-Gly-Ser-Gly-Pro-Phe-Ile-Gly-Tyr-Cys-Cys-Lys-Lys
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 4 and 45, 6 and 35, and 28 and 46.