GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

δ-hexatoxin-Mg1a   Click here for help

GtoPdb Ligand ID: 7569

Synonyms: Delta-HXTX-Mg1a | neurotoxin magi-4
Compound class: Peptide
Comment: Spider toxin from Macrothele gigas.
Click here for help
Peptide Sequence Click here for help
CGSKRAWCKEKKDCCCGYNCVYAWYNQQSSCERKWKYLFTGEC
Cys-Gly-Ser-Lys-Arg-Ala-Trp-Cys-Lys-Glu-Lys-Lys-Asp-Cys-Cys-Cys-Gly-Tyr-Asn-Cys-Val-Tyr-Ala-Trp-Tyr-Asn-Gln-Gln-Ser-Ser-Cys-Glu-Arg-Lys-Trp-Lys-Tyr-Leu-Phe-Thr-Gly-Glu-Cys
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 1 and 14, 8 and 20, 14 and 31, and 16 and 43.